PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m011331
Common NameLOC8258447, RCOM_1674060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Dof
Protein Properties Length: 357aa    MW: 39296.6 Da    PI: 8.5527
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m011331genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-3953113262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  30190.m011331  53 PQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 113
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.9E-3455111IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2756111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52557111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MLGNCEKMVV ISPTTNEWPQ NQIDEKSLMV SSTSKLMEKR GQDPSQPQQQ QQPQQALKCP  60
RCDSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCRKNK RVKRPSSSGG  120
EGTINQVSSV NPNNPSSHQT PIDHITSTSN HINHLFYGLP TNPSEMNLPF GRFNSRVSSN  180
MDTGYDLPPQ LNALALGFSS GILGNNEANN GFNPTKHIQD SVTSTSLLTN YSSIFGCSSS  240
STATTSPSIA TLLASSLHQQ NKFSVKDSNR APNHFQNLTP FEDLQMSCNS TESGIAMKEV  300
KTEQGQSRLH WNMPCQNQIE QMGFSSSEPS LYWNPNTSSV GTWHDPANIG SSVTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647381e-95KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509452.10.0PREDICTED: dof zinc finger protein DOF1.4 isoform X1
TrEMBLB9RBB80.0B9RBB8_RICCO; Zinc finger protein, putative
STRINGPOPTR_0011s05450.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-43Dof family protein